Protein Info for Atu4249 in Agrobacterium fabrum C58

Annotation: sugars ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 114.9 bits, see alignment E=9e-37 PF17912: OB_MalK" amino acids 235 to 278 (44 residues), 47.8 bits, see alignment 4.5e-16 PF08402: TOBE_2" amino acids 272 to 338 (67 residues), 35.4 bits, see alignment E=1.9e-12

Best Hits

Swiss-Prot: 62% identical to Y4OS_SINFN: Uncharacterized ABC transporter ATP-binding protein y4oS (NGR_a02170) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to atu:Atu4249)

MetaCyc: 59% identical to ABC-type 3-(6-sulfo-alpha-D-quinovosyl)-sn-glycerol transporter ATP-binding subunit (Agrobacterium fabrum)
7.5.2.M1 [EC: 7.5.2.M1]

Predicted SEED Role

"Maltose/maltodextrin transport ATP-binding protein MalK (EC 3.6.3.19)" in subsystem Maltose and Maltodextrin Utilization (EC 3.6.3.19)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.19

Use Curated BLAST to search for 3.6.3.19 or 7.5.2.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGB0 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Atu4249 sugars ABC transporter ATPase (Agrobacterium fabrum C58)
MAPVTLKSVKKSYGALATIHGVDIDIADGEFVVLVGPSGCGKSTLLRMIAGLETITGGDI
SISNRVVNEIEPKDRDIAMVFQNYALYPHMTVARNMAFSLEHRGGSKAEVAERVNWAAEI
LGLTPLLERFPRQLSGGQRQRVAMGRAIVRNPQVFLFDEPLSNLDAKLRVVMRGEIKGLH
QRLGVTTVYVTHDQVEAMTMADKIVVMNAGRVEQCGAPLELYDRPSNPFVAGFIGSPAMN
FIKGRLTADGFEADGVTLPLPPGHVSGDAIYGIRPEHFELADHGLPATVLLVEPMGSETQ
VTMMLGHHQVIGVFRERVQAQPGATIQVQPDLASIHLFDAATSQRLN