Protein Info for Atu4240 in Agrobacterium fabrum C58

Annotation: alkanal monooxygenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00296: Bac_luciferase" amino acids 1 to 314 (314 residues), 170.7 bits, see alignment E=2.7e-54

Best Hits

Swiss-Prot: 72% identical to TGNB_ACIAD: Flavin-dependent trigonelline monooxygenase, oxygenase component (tgnB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4240)

Predicted SEED Role

"Alkanal monooxygenase alpha chain (EC 1.14.14.3)" (EC 1.14.14.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.14.14.3

Use Curated BLAST to search for 1.14.14.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CGA2 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Atu4240 alkanal monooxygenase subunit alpha (Agrobacterium fabrum C58)
MKFSLFVHMERLDASQDHKTLYEEFVTLCEIADRGGMHAIWTGEHHGMDFTIAPNPFVTI
ADLARRTKTARLGTGTVIAPFWHPIKLAGEAAMTDLICDGRLDIGIARGAYSFEYERLLP
GLDAWGAGQRMRELIPAVKGVWAGDYAHDGEFFKFPATTSAPKPLQQPFPPIWVAARDPN
SHEFAVANDCNVQVTPLWQGDDEVETLMGRFNHACAKNPEKQRPKIMLLRHTYVGSDEAD
IAQAAHEMSVYYNYFFAWFKNETPVHQGLIERIAPEDIAGNAMLSGDVMRKNNVVGDADD
VIARLKAYEAMGYDEYSFWIDTGMSFERKKASLERFLSDVMPAFAE