Protein Info for Atu4229 in Agrobacterium fabrum C58

Annotation: glutamate synthase large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01645: Glu_synthase
  • amino acids 80 to 332 (253 residues), 262 bits, E=1.9e-81
  • amino acids 356 to 404 (49 residues), 25.3 bits, 1.7e-09
• PF01070: FMN_dh
  • amino acids 221 to 332 (112 residues), 49.4 bits, E=7.4e-17
• PF03060: NMO
  • amino acids 241 to 330 (90 residues), 38.8 bits, E=1.5e-13
• PF00478: IMPDH
  • amino acids 242 to 325 (84 residues), 34.9 bits, E=1.9e-12

Best Hits

Swiss-Prot: 96% identical to GLXD_RHIME: Glutamate synthase large subunit-like protein (glxD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4229)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

See A9CG94 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Atu4229 glutamate synthase large subunit (Agrobacterium fabrum C58)
MSYHNPFTPPRKSATFDDHTLAEIRRAAATGIYDIRGAGTKRKVPHFDDLLFLGASISRY
PLEGYREKCDTTVTLGTRFAKKPITLKTPITIAGMSFGALSGNAKEALGRGATIAGTSTT
TGDGGMTDEERGHSQTLVYQYLPSRYGMNPKDLRRADAIEVVVGQGAKPGGGGMLLGQKI
SDRVANMRNLPKGIDQRSACRHPDWTGPDDLEIKILELREITDWEKPIYIKVGGARPYYD
TALAVKAGADVVVLDGMQGGTAATQDVFIENVGMPTLACIRPAVQALQDLGMHRKVQLIV
SGGIRSGADVAKALALGADAVAIGTAALVALGDNDPHWEEEYQKLGTTAGAYDDWHEGKD
PAGITTQDPELAARLDPVAAGRRLANYLKVMTLEAQTIARACGKNHLHNLEPEDLVALTM
EAAAMAQVPLAGTNWFPGKGSF