Protein Info for Atu4210 in Agrobacterium fabrum C58

Annotation: sugars ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 143 to 170 (28 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 287 to 307 (21 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 182 to 342 (161 residues), 36.8 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu4210)

Predicted SEED Role

"ABC transporter, membrane spanning protein [sugars]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUB7 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Atu4210 sugars ABC transporter permease (Agrobacterium fabrum C58)
MSLSHPATSADWKRLESRGFANRAGFLTAIILFLTVVSVPVLLPYLWLAVKSLTSSDDAV
SRLVLWRSTGIAGVAYLGAIVIAILADRLRRPVFAWAALGLVVVILGGIGLFPHLTFENY
RFLWNRDIAGTGTTRMDLLPSIWTALGSSLVFAISQTLIVTLVATPAAYALSRFAFAGRE
NFLRGLLLLHAFPALALTVAIFIQLHYMGLLNSLTGVVLVMSALELPFAIFVLKGFFDNV
PWDIEMSAVTDGATRSQAFRMVVLPQVRGGLIAVATFTFLRGWEEYVFVQTLLIDKSHMT
MSLYLFFVAQDNMGADYGMIAAVGVVYLLPVLILYTFTQKYITQMSFGGIKG