Protein Info for Atu4195 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 PF00005: ABC_tran" amino acids 27 to 193 (167 residues), 93.2 bits, see alignment E=6.6e-30 amino acids 307 to 464 (158 residues), 99.1 bits, see alignment E=1e-31 PF08352: oligo_HPY" amino acids 245 to 282 (38 residues), 27.2 bits, see alignment 1.2e-09 amino acids 515 to 551 (37 residues), 38.6 bits, see alignment 3.4e-13

Best Hits

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to atu:Atu4195)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CUA2 at UniProt or InterPro

Protein Sequence (568 amino acids)

>Atu4195 oligopeptide ABC transporter ATPase (Agrobacterium fabrum C58)
MKPAKPLLEVRNLVTEFPLRTGVFRAVNDISFSIEPGKTLCVVGESGSGKSVTARSILQI
IDSPGYITSGSIILNKADGSSVDLAKLDPRGRAIRAVRGADIAMIFQEPMSSLSPVHTVG
DQITEVLRLHLKMSKAQARAEAIELLRQVEIPNPEKALDRYAFQYSGGMRQRAMIAMALA
CKPQLLIADEPTTALDVTTQAEILDLISRLQKAHGMAVLFITHDMGVVAQIADDVLVMHH
GVVKEYGTVEQIFHKPQDPYTRMLIGSVLKLEQKAEIRLARPPLDQTAAPILEVKDLSMH
FGEMKALDGVSIKLLPGETLGIVGESGSGKTTMGRSIMRLYDPTAGEMLYRRADGSVVDL
SKIEGKELKAARRELRMVFQDPFGSLNPRMTVAQVIGEPLLVNGIAKGKELEERVCSLME
QVGLDPSGRERYPHAFSGGQRQRIGIARAITLRPRIIVADEATSALDVSVRFQVLDLLMK
LQDELGLAYIFISHDIGVIRYMCDRVGVMYRGKLVEVGEAEKVCNAPDHPYTQALLSAIP
RPDPRDRDRTRRFRYVEPAPIKNGAAAQ