Protein Info for Atu4194 in Agrobacterium fabrum C58

Annotation: oligopeptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 33 to 56 (24 residues), see Phobius details amino acids 169 to 194 (26 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 289 to 318 (30 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details PF12911: OppC_N" amino acids 19 to 71 (53 residues), 42.4 bits, see alignment 5.2e-15 PF00528: BPD_transp_1" amino acids 184 to 371 (188 residues), 100.2 bits, see alignment E=1.2e-32

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu4194)

Predicted SEED Role

"Possible rhamnose ABC transporter, permease component 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG73 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Atu4194 oligopeptide ABC transporter permease (Agrobacterium fabrum C58)
MADIAVATTIRPDRAAVASQWQLIWWAFKRHRLAMAALVVTIAMYVVALVPGFFAINDPV
LQNARATFYPPQRVHLIDTTDGFSVGLHYYPLKLTRNPETLAAVFVEDTGKKIPIQLFGR
GYEYSVLGLFDTNIHLLASTDKTRPLFLFGADRLGRDVFSRVVQGSQISLSIGLVGVFFS
LLLGVVLGGISGYYGGRIDFVMQRVIDFVLSLPTIPIWLAMAAALPQGWPATLQYMMITI
ILSLTGWAQLARVVRGRFLSLRTEEFVAAARLDGVPEGRIIFRHMLPSFSSHIIASVTLA
VPAMILAETSLSFLGLGLQPPTISWGVLLREAQNIRSIATAPWLFLPGVAVVVAVMALNL
LGDGLRDAADPYNK