Protein Info for Atu4174 in Agrobacterium fabrum C58

Annotation: peptide chain release factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR00019: peptide chain release factor 1" amino acids 7 to 356 (350 residues), 504.9 bits, see alignment E=5.5e-156 PF03462: PCRF" amino acids 13 to 204 (192 residues), 238.1 bits, see alignment E=7.8e-75 PF00472: RF-1" amino acids 211 to 320 (110 residues), 146.3 bits, see alignment E=3.7e-47

Best Hits

Swiss-Prot: 100% identical to RF1_AGRFC: Peptide chain release factor 1 (prfA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02835, peptide chain release factor 1 (inferred from 100% identity to atu:Atu4174)

Predicted SEED Role

"Peptide chain release factor 1" in subsystem LMPTP YwlE cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U8B8 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Atu4174 peptide chain release factor 1 (Agrobacterium fabrum C58)
MAKLPVEKMRELERRFGEIEARMSAGPAADVYVKLASEYSELEPVVKKIRDYEKAISEAA
DLEALLADKTTDKDMRDLAEMELPEVETRIRELEKDMQVLLLPKDAADEKSAILEIRAGT
GGSEAALFAGDLFRMYERFAATKGWKVEVLSASEGEAGGYKEIIATITGRGVFSKLKFES
GVHRVQRVPETEASGRIHTSAATVAVLPEAEDIDVEIRPEDIRIDTMRASGAGGQHVNTT
DSAVRITHLPTGLIVTSSEKSQHQNRAKAMQVLRSRLYDIERQKVDSERSADRKSQVGSG
DRSERIRTYNFPQGRVTDHRINLTLYKLDRVIEGEIDELVDALIADYQAGQLAQLGEQQL