Protein Info for Atu4150 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 48 (19 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 236 to 252 (17 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details PF00892: EamA" amino acids 3 to 136 (134 residues), 52.2 bits, see alignment E=4e-18 amino acids 145 to 274 (130 residues), 29.2 bits, see alignment E=5e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4150)

Predicted SEED Role

"FIG00794985: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG57 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Atu4150 hypothetical protein (Agrobacterium fabrum C58)
MQKGFLLGLFAYATFSMGDATIKSLGSQISVFEIGFFSILFSGIFIFFSKPREERWREFW
RMSRPFAVHGRAISGLFAGIFGIYAFTTIPLAEAYALIFLSPLFVTVLSAVVLKENIGPW
RWAAVLAGIVGVILVVRPGFKTLELGHIAAIGVAFLAAMTIVLLRSLAGKEKRTSIMGVL
LIYGLTFNGIASIPDFVMPNLHQLLAFAFIGLCTATGQITLLVATRIAPASQIAPSHYSQ
ILWAVAIGMTFFHEYPDAIAALGLAVIAASGLLTMIREKVRLGTVRWNPFFRNRL