Protein Info for Atu4148 in Agrobacterium fabrum C58

Annotation: UDP-glucuronic acid epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 PF04321: RmlD_sub_bind" amino acids 1 to 184 (184 residues), 39.6 bits, see alignment E=1.1e-13 PF01370: Epimerase" amino acids 4 to 232 (229 residues), 172.2 bits, see alignment E=3.9e-54 PF16363: GDP_Man_Dehyd" amino acids 4 to 324 (321 residues), 166.9 bits, see alignment E=2.7e-52 PF02719: Polysacc_synt_2" amino acids 4 to 230 (227 residues), 49.7 bits, see alignment E=9.3e-17 PF01073: 3Beta_HSD" amino acids 4 to 229 (226 residues), 54.6 bits, see alignment E=2.6e-18 PF07993: NAD_binding_4" amino acids 74 to 184 (111 residues), 32 bits, see alignment E=2.2e-11

Best Hits

Swiss-Prot: 81% identical to LPSL_RHIME: UDP-glucuronate 5'-epimerase (lspL) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01789, UDP-glucuronate 5'-epimerase [EC: 5.1.3.12] (inferred from 100% identity to atu:Atu4148)

Predicted SEED Role

"UDP-glucuronate 5'-epimerase (EC 5.1.3.12)" (EC 5.1.3.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG55 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Atu4148 UDP-glucuronic acid epimerase (Agrobacterium fabrum C58)
MRYLVTGTAGFIGFYVAKRLLDAGHFVTGFDGMTKYYDVSLKEKRHAILARSNGFRAEIG
MLEDTDALKRAAEAAEPEIIIHLAAQAGVRYSLENPRAYIDSNLIGSFNMLELARSLKVK
HLMLASTSSIYGANEKIPFAESDKADEPMTLYAATKKSMELMAHSYAHLHKLPTTAFRFF
TVYGPWGRPDMAPIKFVDAVSNGQPIDIYGQGNMSRDFTYIDDLVEGIVRLSAVIPSEEN
RVTQEGVTDTLSHHAPFRVVNIGGGQPVELMHFVETIEKAVGKPAIRNMLPMQQGDVPRT
FASPDLLRALTGYVPQTPVEEGIKALVAWYRGINGNLTE