Protein Info for Atu4140 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details TIGR02587: putative integral membrane protein TIGR02587" amino acids 16 to 286 (271 residues), 467.7 bits, see alignment E=5.7e-145 PF09622: DUF2391" amino acids 22 to 286 (265 residues), 334.1 bits, see alignment E=3.1e-104

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4140)

Predicted SEED Role

"FIG028593: membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CG52 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Atu4140 hypothetical protein (Agrobacterium fabrum C58)
MAVAVSRKHADDDEVRQFLTGLARGTAGALLFALPMLMTMEMWFLGLYVNPWRLLLLCIL
NLPLLFLLARRIGFEKTDSWRQAWRDTLTAYGLGIMVSAAVLLLFGILNDQLTASNIVAK
VALQSVPASIGALLGRSQLGQRSDAEDEEEGEYSGETGYLHELFMMMVGALFLSLNVAPT
EEMILIAYKVTPYHILALCLLSIAIMHGFVYALHFRGSHRLHEGQQWWQAFIRFTLPGYV
VAIAISIYTLWTFERLDHTSLSQIMNAAVILGVPASIGAASARLIL