Protein Info for Atu4098 in Agrobacterium fabrum C58

Annotation: quinolinate synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 TIGR00550: quinolinate synthetase complex, A subunit" amino acids 50 to 345 (296 residues), 321.3 bits, see alignment E=3.1e-100 PF02445: NadA" amino acids 54 to 344 (291 residues), 380.3 bits, see alignment E=3.1e-118

Best Hits

Swiss-Prot: 100% identical to NADA_AGRFC: Quinolinate synthase A (nadA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to atu:Atu4098)

MetaCyc: 41% identical to quinolinate synthase (Thermotoga maritima)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U8J3 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Atu4098 quinolinate synthetase (Agrobacterium fabrum C58)
MLTMRICLRATYTQKEYKWESTVNEQISAASLYDRVARVIPKAEWMGFQDDVEAILELKR
KRNAVILAHNYQTPEIFHGVADIVGDSLALARKAMEVEADVIVLAGVHFMAETAKLLNPE
KTVLIPDMAAGCSLADSITPEDIALLRKAYPGVPVVTYVNTSAAVKAASDICCTSGNARQ
VVESLGVPRVLMLPDEYLAKNVAKETSVELIAWRGHCEVHELFTADDIRELRESHPGVIV
LAHPECPPEVVDAADFSGSTAVMSDYVGRERPARVVLLTECSMSDNVAVHHPDVEFIRPC
NLCPHMKRITLGNIRTALEENRHEVTVDPAIAGAARRAVERMLQI