Protein Info for Atu4075 in Agrobacterium fabrum C58

Annotation: glycogen synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 TIGR02095: glycogen/starch synthase, ADP-glucose type" amino acids 1 to 475 (475 residues), 575.5 bits, see alignment E=4.2e-177 PF08323: Glyco_transf_5" amino acids 2 to 234 (233 residues), 242.2 bits, see alignment E=9.7e-76 PF00534: Glycos_transf_1" amino acids 288 to 418 (131 residues), 45.9 bits, see alignment E=6.9e-16 PF13692: Glyco_trans_1_4" amino acids 292 to 413 (122 residues), 35 bits, see alignment E=2.6e-12

Best Hits

Swiss-Prot: 100% identical to GLGA1_AGRFC: Glycogen synthase 1 (glgA1) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00703, starch synthase [EC: 2.4.1.21] (inferred from 100% identity to atu:Atu4075)

Predicted SEED Role

"Glycogen synthase, ADP-glucose transglucosylase (EC 2.4.1.21)" in subsystem Glycogen metabolism (EC 2.4.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.21

Use Curated BLAST to search for 2.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A3F2 at UniProt or InterPro

Protein Sequence (480 amino acids)

>Atu4075 glycogen synthase (Agrobacterium fabrum C58)
MNVLSVSSEIYPLIKTGGLADVVGALPIALEAHGVRTRTLIPGYPAVKAAVTDPVKCFEF
TDLLGEKADLLEVQHERLDLLILDAPAYYERSGGPYLGQTGKDYPDNWKRFAALSLAAAR
IGAGVLPGWRPDMVHAHDWQAAMTPVYMRYAETPEIPSLLTIHNIAFQGQFGANIFSKLA
LPAHAFGMEGIEYYNDVSFLKGGLQTATALSTVSPSYAEEILTAEFGMGLEGVIGSRAHV
LHGIVNGIDADVWNPATDHLIHDNYSAANLKNRALNKKAVAEHFRIDDDGSPLFCVISRL
TWQKGIDLMAEAVDEIVSLGGRLVVLGAGDVALEGALLAAASRHHGRVGVAIGYNEPLSH
LMQAGCDAIIIPSRFEPCGLTQLYALRYGCIPVVARTGGLADTVIDANHAALASKAATGV
QFSPVTLDGLKQAIRRTVRYYHDPKLWTQMQKLGMKSDVSWEKSAGLYAALYSQLISKGH