Protein Info for Atu4060 in Agrobacterium fabrum C58

Annotation: succinoglycan biosynthesis glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF00535: Glycos_transf_2" amino acids 9 to 143 (135 residues), 80.9 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 63% identical to EXOU_RHIME: Succinoglycan biosynthesis protein ExoU (exoU) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to atu:Atu4060)

MetaCyc: 63% identical to glucosyltransferase ExoU (Sinorhizobium meliloti 1021)
2.4.1.-

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTZ4 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Atu4060 succinoglycan biosynthesis glycosyltransferase (Agrobacterium fabrum C58)
MVSGSQPICVIIAAKNASETIDIAIRSALVEPEVGEVVVIDDGSTDTTSDVAHAADDGTG
RLRVVRFEVNRGPSAARNHAISISSAPLISILDADDFFFRGRFAAMLADDDWDLVADNIA
FIQQSVPGASSMQPARFEPQARYLSLTEFVEGNISRPGVERGETGFLKPVIRRDFLDKHA
LRYDEGLRLGEDYELYVRALAAGARYKVIRHCGYGAIVRGNSLSGRHRTEDLRRLYEADN
AILAGCRLSAEEKAILREHEKHIRAKFELRHFLDAKKQNGMGGALSHALTRLPALPAITR
GIWSDKTARFRKTPPVRDVRYLLDGTPVS