Protein Info for Atu4034 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF01590: GAF" amino acids 29 to 163 (135 residues), 23.5 bits, see alignment E=1.1e-08 PF07730: HisKA_3" amino acids 206 to 267 (62 residues), 24.4 bits, see alignment E=5.3e-09 PF02518: HATPase_c" amino acids 313 to 403 (91 residues), 37.3 bits, see alignment E=4.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu4034)

Predicted SEED Role

"Miscellaneous; Not classified regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTX0 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Atu4034 two component sensor kinase (Agrobacterium fabrum C58)
MLDTPKSALFHHYMGIARLLAGQLEFNAIIQAVATEISHIIPHDHMDVCIKQLDDKYHIA
YESGLVSAWSRQPPALLTGSPIRSLLSGAVEHLLSGDACSDPRFHFEGAFSSPIIELNLH
SRLHVPMKVHGDIIGALSCSSHQSNAYTMEDVANARAVADMLAPYFYAIRAAEQAKRSAI
EEARANAREEGLRLGALQLTEALEAERQRIGMDLHDQTLADLARLARRIERMSHSADVSG
EMLEPVVRSLQHCMQDLREIIEEAKPSILQLFGVVEAIETYVDRSVRDSGSYIEWSVTDE
TGGLVERLDKTVAISLFRIVQEAVNNAIRHAQPETIAVNLTAVDGGLRVTVSDDGNGGGD
GAASGGLGIGNMKTRARLISARFDIGGNRNGAGTCITVILPEDAFDHREDV