Protein Info for Atu4031 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 65 to 82 (18 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 200 to 225 (26 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 40 to 297 (258 residues), 72 bits, see alignment E=2.3e-24

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu4031)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFZ1 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Atu4031 sugar ABC transporter permease (Agrobacterium fabrum C58)
MKLSANALRLIIPAASLAFLLAAVFYMQPRAMSYTGMNLLFNLAVPIALATIAQMLIMSV
NDLDLSMGTFVSFCACVTATFLQTSPLTGIAIFAGAIAVYAVLGAVIHIRNLPSIVVTLG
MSFVWGGLAVLILPSPGGQAPAFIRTLMTAKPPFVPIAIVASILIAVVAHYIVMRSSFGV
LMRGVGGNFRSVERSGWSVVGIRAATFALAGFFAVLSGIALVGLTTAADANIALRYTLLS
IAGVILGGGEFVGGRVSPIGAVIGALTLTLAGSFLSFMRISPDWQIGAQGAILIIVLALR
ILLNRLEKREKNQ