Protein Info for Atu4018 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 153 to 173 (21 residues), see Phobius details PF26769: HAMP_PhoQ" amino acids 177 to 222 (46 residues), 32.1 bits, see alignment 1.4e-11 PF00512: HisKA" amino acids 228 to 290 (63 residues), 45.8 bits, see alignment E=7.5e-16 PF02518: HATPase_c" amino acids 341 to 443 (103 residues), 57 bits, see alignment E=3.9e-19

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to atu:Atu4018)

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTV5 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Atu4018 two component sensor kinase (Agrobacterium fabrum C58)
MARPTSMTRKLVTALTSVVAISWLLACGLGVMAMQDEFAEIFDAGLEETSERLLPLLLDD
LRENNTAPAAQKLNQSAEGAEYLTYQVRDREGQVVLHSHDSSTEPFEVGLDPGFSETSSQ
RIFTVASPDGNYFLQVADAFANRREAIIEAGSALMLPVLILIPASIIAVIVVVRRALQPV
QTLRDEIGKKDGGNLAPLATQPFPAELHPIARSVNLLLGRLRSTIEAEREFTANSAHELR
TPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAHLAEKLLQMSRAEAKIGVTDKTSD
LIPVLELVVDDMSRTAIGTSRIRFTNRCEGGLPCQIGADAFGIIIRNLLENALIHSPAES
PVQAIAETDGTIRIVNSGPAVDPALLPKLTTRFTRGPTTADGTGLGLAIVKSLVEQAGGE
LVLSSPVSGLQDGFEARVILPVQTA