Protein Info for Atu4007 in Agrobacterium fabrum C58

Annotation: arginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00491: Arginase" amino acids 2 to 294 (293 residues), 239.1 bits, see alignment E=3.4e-75 TIGR01229: arginase" amino acids 5 to 298 (294 residues), 306.7 bits, see alignment E=9.1e-96

Best Hits

Swiss-Prot: 68% identical to ARGI_BRUSU: Arginase (arcB) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01476, arginase [EC: 3.5.3.1] (inferred from 100% identity to atu:Atu4007)

MetaCyc: 61% identical to arginase subunit (Agrobacterium tumefaciens)
Arginase. [EC: 3.5.3.1]

Predicted SEED Role

"Arginase (EC 3.5.3.1)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.3.1

Use Curated BLAST to search for 3.5.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTU5 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Atu4007 arginase (Agrobacterium fabrum C58)
MDIRLVGAPLQIGAGQLGCEMGPSAYRVAGLAHALEELGHRVVDTGNVMPAPLREFCHPN
PAVHHLAETVAWTEALTEAAYRESADAVPIFLGGDHAISAGTVAGMARRVAETGRPFFVL
WLDAHTDYHTLETTRSGNLHGTPVAYFSGRDGFSGYFPPLSHAVAEENIGMIGIRSVDPA
ERAALEKSGITVHDMRSIDEHGVAVILREFLARVQAANGLLHVSLDVDFLEPSIAPAVGT
TVPGGATFREAHLVMEMLHDSGLVCSLDLVELNPFLDERGRTATLMVDLATSLMGKRVMD
RPTRAG