Protein Info for Atu3999 in Agrobacterium fabrum C58

Annotation: dithiobiotin synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13500: AAA_26
  • amino acids 5 to 192 (188 residues), 210.3 bits, E=1.3e-66
• TIGR00347: dethiobiotin synthase
  • amino acids 7 to 158 (152 residues), 116.9 bits, E=4.9e-38

Best Hits

Swiss-Prot: 100% identical to BIOD_AGRFC: ATP-dependent dethiobiotin synthetase BioD (bioD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 100% identity to atu:Atu3999)

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis II (4/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.3

Sequence Analysis Tools

See Q8U8T9 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Atu3999 dithiobiotin synthetase (Agrobacterium fabrum C58)
MSLRFVISGTDTGIGKTVFAAALTHALEAHYWKPVQSGLEEETDSQTVARLAGASHARIL
PEAYRLKTPASPHLSARLDNVSIDPARLLPPRPDGPLVIEGAGGLLVPLTDRLLFADIFA
LWQIPLILCARTALGTINHTLLSLEALRHRAIPVQGVVFIGDEDRENERVITDIGAVRRL
GRLPRLPELTPEALHQAFAQHFNLADFLEVPA