Protein Info for Atu3998 in Agrobacterium fabrum C58

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00155: Aminotran_1_2" amino acids 29 to 365 (337 residues), 151.8 bits, see alignment E=1.5e-48

Best Hits

Swiss-Prot: 42% identical to BIOF_GEOSL: 8-amino-7-oxononanoate synthase (bioF) from Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 100% identity to atu:Atu3998)

MetaCyc: 100% identical to 8-amino-7-oxononanoate synthase (Agrobacterium fabrum C58)
8-amino-7-oxononanoate synthase. [EC: 2.3.1.47]

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFX6 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Atu3998 8-amino-7-oxononanoate synthase (Agrobacterium fabrum C58)
MNIAALSPYEAKLAGLSRKSRLRALAPREGIDFTSNDYLGLAEAPRLKAAIAHAIGKGVP
VGAGGSRLLRGNHPEHEALESEAAAFFGAEKAIYFGSGFAANVALFSTLPLRDDIVLHDA
LIHASVHDGIAAGKAKAVAVPHNEVEAFQREIIRWRQAGGSGRPWIAVESLYSMDGDCAP
LAALADLAERHGGFLVVDEAHATGVFGPGGRGLAAQLEGRSNVLALHTCGKALGASGALL
SLPAVLADYLVNRARGFIYSTAPSPLMAAAVREALRIVADEPSRRSRLAELVGFAGEELQ
SQLGVTPSGSQILPVMIGDNARSLKIAARLSQGGFDVRAIRPPTVPEGTGRLRIAITLNV
DESQIAAMVGLLAVSMREEAA