Protein Info for Atu3975 in Agrobacterium fabrum C58

Annotation: UDP-galactopyranose mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 66% identical to GLF1_KLEPN: UDP-galactopyranose mutase (rfbD) from Klebsiella pneumoniae

KEGG orthology group: K01854, UDP-galactopyranose mutase [EC: 5.4.99.9] (inferred from 100% identity to atu:Atu3975)

MetaCyc: 57% identical to dTDP-fucopyranose mutase (Escherichia coli O52)
RXN-14533 [EC: 5.4.99.59]

Predicted SEED Role

"UDP-galactopyranose mutase (EC 5.4.99.9)" in subsystem LOS core oligosaccharide biosynthesis or linker unit-arabinogalactan synthesis (EC 5.4.99.9)

MetaCyc Pathways

O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
dTDP-β-D-fucofuranose biosynthesis (3/4 steps found)
superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.99.59 or 5.4.99.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTR9 at UniProt or InterPro

Protein Sequence (385 amino acids)

>Atu3975 UDP-galactopyranose mutase (Agrobacterium fabrum C58)
MIADERIVIVGAGLSGAVIGRELALAGHLVDIIDARDHIAGNCHTERDGETGVMVHVYGP
HIFHTDDREVWDYVNSFQTFMPYKNRVKTTSGEQVYSLPVNLHTINQFFGKNFRPDEART
FIEDKADKSITDPQTFEEQALRFVGRDLYEAFFKGYTEKQWGCSPTELPASILKRLPVRF
NYDDNYFFHKYQGMPESGYTDMIERILDHPNITVKLGTRFDRAEAPATGHVFYSGPLDGY
FDFEFGRLAYRTLDFERFTYDGDYQGCAVMNYGDVSVPFTRITEHKHFSPWEDHAGSVCY
REFSRECGPQDIPYYPIRLVEDKEQLADYVARAEREASVTFVGRLGTYRYLDMDATIREA
LDTARLYLARRSEGGSMPAFLHSPV