Protein Info for Atu3969 in Agrobacterium fabrum C58

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 53 to 78 (26 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 251 (176 residues), 73.3 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu3969)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTR3 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Atu3969 sugar ABC transporter permease (Agrobacterium fabrum C58)
MIRRIGLVAQVVDPAKPAEVLKMQFNELKPAEKVALATENYTELFQRFNFPLYFWNSTFI
TVTSTLIMLIVNSMAAFALSKYEFKGRGVVLALVVGTLMIPQTVVLVPLFLITSQLGLIN
SLWGVIIPGAATPTGVFLLRQYMLTIPDEILDAARMDKASEWKIYWRIILPLSAPALAVL
AILAIMWRWNDFLWPLIVLTRNDNFTLQLALNSFQGEMTTEWSNLLAMTVLTLAPIALVF
MFLQKYIATGIASTGGK