Protein Info for Atu3935 in Agrobacterium fabrum C58

Annotation: N-formimino-L-glutamate deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details TIGR02022: formiminoglutamate deiminase" amino acids 1 to 446 (446 residues), 598.9 bits, see alignment E=3e-184 PF22429: HutF_N" amino acids 1 to 45 (45 residues), 60.5 bits, see alignment 1.1e-20 PF01979: Amidohydro_1" amino acids 46 to 420 (375 residues), 90.1 bits, see alignment E=1.8e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3935)

Predicted SEED Role

"Formiminoglutamic iminohydrolase (EC 3.5.3.13)" in subsystem Histidine Degradation (EC 3.5.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTN5 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Atu3935 N-formimino-L-glutamate deiminase (Agrobacterium fabrum C58)
MTAIYAGAALLAGGWARDVRIICEDGIISSVETGVSPQPQDERHAVIVPAMPNLHSHAFQ
RAMAGLAEIRGPGDDSFWSWRTVMYKFALSMTPDHVEAVAAQLYMEMLEAGFGRVGEFHY
LHNDRDGSHYGNIAEMAERIGAAASQTGIGLTLLPVFYAHSGFGGQAPIDGQKRFIHSLD
SYGKLMQGAQAVVDRLPGAVLGIAPHSLRAVTGAELAAIEPLAKGGPIHIHVAEQMKEVE
DSLAFSGARPVQWLLDNAPFDGRWCLIHATHMTETETRRMAKSGAVAGLCPITEANLGDG
IFTAPAFLAEGGHYGVGSDSNILISISEELRTLEYSQRLSLRARNVVADPGCSTGEKLFL
QAIEGGGRALASRNGVEQGKSADFVALDVSAVSYLPLSQILDQWIFAGGIAVDSVWVRGK
KLVQAGRHIHRREISGRFNKVMAELLDS