Protein Info for Atu3930 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 62 to 79 (18 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 170 to 174 (5 residues), see Phobius details amino acids 180 to 190 (11 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 60 to 296 (237 residues), 87.4 bits, see alignment E=3.7e-28 PF12697: Abhydrolase_6" amino acids 62 to 307 (246 residues), 74 bits, see alignment E=8.3e-24 PF03096: Ndr" amino acids 70 to 161 (92 residues), 25.6 bits, see alignment E=1.5e-09 PF12146: Hydrolase_4" amino acids 90 to 295 (206 residues), 57.6 bits, see alignment E=3.7e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3930)

Predicted SEED Role

"putative esterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFU7 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Atu3930 hypothetical protein (Agrobacterium fabrum C58)
MTPRRISLALSFLIGAISPAFSLTVPAAAQGRNAVPVRIDVGGYKLNSLLIEPQKQADLP
PIVFLHGASASLYDPLFSFEDKLRGRARLLFIDRPGHGGSDIGGKDNILPDGQADAVAQL
MKKRGVRKAIIVGHSFGGAITAAFALRHPEMVSGLVFLSPAVYPWPGGIAWYYTAASAPV
TGPLFSTFIAPPLGLLALDQATLGVFAPNNRPPGYVEATRAWAALRPQAFRHNAREVAGL
NAWARSAAPNYSKIKAPTVIITGDTDTVVSPEIHSLQLARDIDRSTLIVVKNLGHKSDYI
ARDLVVEAIEKLAGKRADLRAAQKELEHRIADDGGK