Protein Info for Atu3909 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 232 to 258 (27 residues), see Phobius details amino acids 286 to 311 (26 residues), see Phobius details amino acids 322 to 339 (18 residues), see Phobius details amino acids 345 to 369 (25 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details PF01566: Nramp" amino acids 51 to 382 (332 residues), 75.6 bits, see alignment E=1.9e-25

Best Hits

Swiss-Prot: 52% identical to YCSG_BACSU: Uncharacterized membrane protein YcsG (ycsG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3909)

Predicted SEED Role

"FIG038418: hypothetical protein clustering with LamB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTL5 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Atu3909 hypothetical protein (Agrobacterium fabrum C58)
MEQKKLTPTADLKMSKRASLLGAIFLMATSAIGPGFITQTATFTTQLGAAFAFGILASIL
IDFVVQLNIWRIVTLTRMRASDIANAAIPGAGYFLAILVIIGGLFFNIGNIGGTGLGLNA
IFGLDPKIGGAISAIFSIAIFVSKRAGLAVDRFIIFAGILMIVLTLYVAFVSAPPVGDAF
RQTFLPDTINFATITTIVGGTVGGYITYSGAHRLLDRGMVGIENLPAVNRAALTGIAVTG
IMRYVLFLAILGVVASGVVIDTSGQAANPAAQAFRSAAGDLGFRLFGIIFWAAAITSVIG
AAYTSVSFLPVFKQDMSERARNMATVVFIAVSLVCYLLITTPPAAMLVFVGGLNGLILPI
GLSIFLFAAWKREDLMGGHRYSRILLGLGVLTCALTWYMGYKSAGTIFGLLGL