Protein Info for Atu3886 in Agrobacterium fabrum C58

Annotation: lysophospholipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 121 to 141 (21 residues), see Phobius details amino acids 168 to 184 (17 residues), see Phobius details PF12146: Hydrolase_4" amino acids 43 to 296 (254 residues), 144.8 bits, see alignment E=4.1e-46 PF00561: Abhydrolase_1" amino acids 46 to 295 (250 residues), 51.5 bits, see alignment E=1.7e-17 PF12697: Abhydrolase_6" amino acids 47 to 295 (249 residues), 46.6 bits, see alignment E=1e-15

Best Hits

KEGG orthology group: K01048, lysophospholipase [EC: 3.1.1.5] (inferred from 100% identity to atu:Atu3886)

Predicted SEED Role

"Lysophospholipase L2 (EC 3.1.1.5)" in subsystem Synechocystis experimental or Triacylglycerol metabolism (EC 3.1.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.5

Use Curated BLAST to search for 3.1.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFS8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Atu3886 lysophospholipase (Agrobacterium fabrum C58)
MIEATLRASEDNPVPGNQTVGYFTGHGGKQLRYAIFRATRSIARGTVVLLHGRNECIEKY
FETVADLTAMGFWVATFDTRGQGGSERLLKKPGVGHVRRFSDYQRDISLFLEQVVLPDTR
LPFFMIAHSTGALAALAAAPGLSNRIDRLALCSPFIELDSQQSVPRSVIRLVATALSLVG
LGRVQLGRDQRERDFDGNPLTSDARRFARNLTLHRQFPELFIGAPTARWVYEALKTMGRV
TRQDHLTNITVPTLILAPMLDTITPYKAQEELSRNFRAAQLLPITGARHELLHERDVFRK
QALAAIDAFFAPE