Protein Info for Atu3869 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF00005: ABC_tran" amino acids 21 to 190 (170 residues), 88.5 bits, see alignment E=1.5e-28 amino acids 342 to 471 (130 residues), 72.2 bits, see alignment E=1.7e-23 PF12848: ABC_tran_Xtn" amino acids 229 to 310 (82 residues), 87.8 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 100% identity to atu:Atu3869)

Predicted SEED Role

"ATP-binding protein of ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTH7 at UniProt or InterPro

Protein Sequence (540 amino acids)

>Atu3869 ABC transporter permease (Agrobacterium fabrum C58)
MIRIENISKSNSHRILYIEASAALNRGEKIGLVGPNGAGKTTLFRMITGEDQPDEGQVVV
EKGMTVGYFDQDVGEMSGHSAVAEVMEGAGPVSEVAAELRELEAAMSDPDRMDEMDAIIE
RYGEVQARYEELDGYALEGRAREVLDGLSFSQEMMDGDVSKLSGGWKMRVALARILLMRP
DVMLLDEPSNHLDLESLIWLEDFLKNYDGALLMTSHDREFMNRIVTKIIEIDAGSLTTYS
GDYGFYEQQRAQNEKQQQAQFERQQAMLAKEIKFIERFKARASHASQVQSRVKKLEKIDR
VEPPKRRQTVAFEFAPAPRSGEDVVALKKVNKAYGSRTIYGELDFMVRRKERWCIMGVNG
AGKSTLLKLVTGTTAPDSGNVTLGASVKLGYFAQHAMDVLDGDSTILEWLEERFPKAGQA
PLRALSGCFGFSGDDVEKRCRVLSGGEKARLVMAAMLFDPPNFLVLDEPTNHLDLDTKEM
LIKALSDYEGTMLFVSHDRHFLAALSNRVLELTPDGIHQFGGGYTEYVESTGQEAPGLRS