Protein Info for Atu3806 in Agrobacterium fabrum C58
Annotation: methionine gamma-lyase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 100% identity to atu:Atu3806)Predicted SEED Role
"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)
MetaCyc Pathways
- aspartate superpathway (24/25 steps found)
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- superpathway of S-adenosyl-L-methionine biosynthesis (8/9 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
- superpathway of L-homoserine and L-methionine biosynthesis (7/8 steps found)
- L-methionine degradation II (3/3 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- L-methionine biosynthesis I (4/5 steps found)
- seleno-amino acid detoxification and volatilization III (2/3 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
- dimethyl sulfide biosynthesis from methionine (1/2 steps found)
- seleno-amino acid detoxification and volatilization I (1/2 steps found)
- L-threonine degradation I (3/6 steps found)
- superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)
- homocysteine and cysteine interconversion (1/4 steps found)
- superpathway of L-threonine metabolism (11/18 steps found)
- superpathway of seleno-compound metabolism (8/19 steps found)
- hypoglycin biosynthesis (4/14 steps found)
KEGG Metabolic Maps
- Biosynthesis of plant hormones
- Cysteine metabolism
- Methionine metabolism
- Selenoamino acid metabolism
- Sulfur metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.48
Use Curated BLAST to search for 2.5.1.48 or 4.4.1.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A9CFP4 at UniProt or InterPro
Protein Sequence (427 amino acids)
>Atu3806 methionine gamma-lyase (Agrobacterium fabrum C58) MTAPHPSKTHIGNHALHPETQMLNYGYDPELSEGAVKPPVFLTSTFVFKSAEDGRDFFDY VSGRKEPPAGKGAGLVYSRFNHPNSEIVEDRLAVYERTESCALFSSGMSAISTTLFAFVR PGDTVLHSQPLYGGTETLLAKTFHNFGVSAVGFADGVSEASVMAAAETAMAKGRVSVILI ETPANPTNSIVDVAMMRRVADVIGEKQGHRPIIACDNTLLGPVFQQPIEHGADISLYSLT KYVGGHSDLIAGAALGRKDVMKQVKALRGAIGTQLDPHSCWMLGRSLETLQIRMERANSN AKIVAEFLKAHPKVEKIHYLPFSDPASAVGKVFAAQCSGAGSTFSFDIVGGQPASFKFLN ALTIFKLAVSLGGTESLASHPATMTHSGVPADVRQRIGVLDSTIRLSIGIEHPDDLIADL TLALDMS