Protein Info for Atu3799 in Agrobacterium fabrum C58

Annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 32 to 50 (19 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details TIGR02018: histidine utilization repressor" amino acids 100 to 326 (227 residues), 331.1 bits, see alignment E=1.5e-103 PF00392: GntR" amino acids 101 to 164 (64 residues), 70.2 bits, see alignment E=1.4e-23 PF08220: HTH_DeoR" amino acids 117 to 160 (44 residues), 23.8 bits, see alignment 4.6e-09 PF07702: UTRA" amino acids 186 to 322 (137 residues), 106.7 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: K05836, GntR family transcriptional regulator, histidine utilization repressor (inferred from 100% identity to atu:Atu3799)

Predicted SEED Role

"Histidine utilization repressor" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CTC1 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Atu3799 GntR family transcriptional regulator (Agrobacterium fabrum C58)
MPALSGKLLPRRWAGAGLSPRSSAVDLRLLEIESSLAIIFPSSCICNFTHLHKTSKIGCD
NFVLVQILAAFCAVARFLGVSMLPVIESEFPVSGDRSSLPLYERVKEQIKEKIASGQWLT
NHRIPSENEMVDMLGVSRMTANRALRELATEGVIVRVQGRGSFVAPKKRSAGLMGVRNIA
DEIKERGSTHRPSLILAQTEVCGPDLATALEIGVGTKVFHSIIVHHEDDVPIQLEDRFVN
AEIAPDYLMQDFTTLTPNAYLTAAAPISRTEQFIEAASPQPWECKLMAISRNEPCLLVRR
RTWSSSRAVTSVRLLYPGSRYRLESQE