Protein Info for Atu3797 in Agrobacterium fabrum C58

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 33 to 351 (319 residues), 238.4 bits, see alignment E=4.9e-75 PF25917: BSH_RND" amino acids 60 to 193 (134 residues), 44.1 bits, see alignment E=3.1e-15 PF25973: BSH_CzcB" amino acids 63 to 198 (136 residues), 31.1 bits, see alignment E=3.5e-11 PF25876: HH_MFP_RND" amino acids 99 to 167 (69 residues), 38.9 bits, see alignment E=1.8e-13 PF25967: RND-MFP_C" amino acids 285 to 340 (56 residues), 24.9 bits, see alignment E=3.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3797)

Predicted SEED Role

"HlyD family secretion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFN9 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Atu3797 HlyD family secretion protein (Agrobacterium fabrum C58)
MKTILIAAALGGIFALASCSSEEPPAEKPLRTVDVVAAEKKPVDRGSVITGEVRARVQTD
LSFRVSGKIIERLVDVGARVKTGQLLARIDPEEQKADIDVALANLQSAEAQQTQAQLTFD
RQQNLFKTQVTSRSAVDKAQETLLTTQGAVRSAQAQLDTARDALSYTELRADADGVITAR
NVEVGQVAQAAQLVFTLAHDGPRDAVFDVYESLFLERDIDNLVNVSLLSDPAQIVAAPVR
EISPTIDPDNGTIRVKVGLNGDMTMPLGAPVSGHFRFRQIDAIELPWSAMASQDGAPAVW
LVDPRSSEVAMRPVQVADYETGQFVVTEGLNPGDLVVTVGTKFLRAGEKVAYEKGQAQ