Protein Info for Atu3792 in Agrobacterium fabrum C58

Annotation: L-asparagine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 350 to 372 (23 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 420 to 441 (22 residues), see Phobius details amino acids 447 to 467 (21 residues), see Phobius details PF00324: AA_permease" amino acids 30 to 464 (435 residues), 365.2 bits, see alignment E=5.1e-113 PF13520: AA_permease_2" amino acids 31 to 456 (426 residues), 149.4 bits, see alignment E=1.6e-47

Best Hits

Swiss-Prot: 61% identical to ANSP2_MYCTO: L-asparagine permease 2 (ansP2) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K11738, L-asparagine permease (inferred from 100% identity to atu:Atu3792)

Predicted SEED Role

"L-asparagine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFN5 at UniProt or InterPro

Protein Sequence (485 amino acids)

>Atu3792 L-asparagine permease (Agrobacterium fabrum C58)
MHSGKTAPAEREVFVEEDLGYHKALKPRQIQMIAIGGAIGTGLFLGAGGRLAQAGPALVF
VYALCGFFAFLVLRALGELIMHRPSSGSFVSYAREFYGEKMAFAAGWMYWLNWAMTSVAD
VTAVALYMNFFKQYVPWLAGIDQWVFAMTALVVVLAMNMLSVKVFGELEFWFSLIKVLAL
AIFLVVGVYFVIFGTPIEGHVTGFSLITDNGGFFPNGILPAFVIIQGVVFAYASIELIGT
AAGETEDPRKVMPRAIRAVVLRLVVFYVGSVLLFTLLLPYTAYKAGESPFVTFFGSIGVE
GADVIMNLVVLTAVLSSLNAGLYSTGRILHSMAVSGSAPAALAKMNKNGVPYGGIAVTAV
VTVLGVALNAVVPSSAFEIALNLSALGIICAWAVIVLCQLKLWQLSQRGEIVRPDFRMFG
APYTGILTLIFLFGVLVLMAFDYPVGSWTIASLIVIIPALVIGWYLLRDRIYRLAAERAG
SGVSH