Protein Info for Atu3790 in Agrobacterium fabrum C58

Annotation: potassium-transporting ATPase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 382 to 401 (20 residues), see Phobius details amino acids 421 to 444 (24 residues), see Phobius details amino acids 484 to 508 (25 residues), see Phobius details amino acids 529 to 552 (24 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 560 (560 residues), 776.1 bits, see alignment E=1e-237 PF03814: KdpA" amino acids 11 to 559 (549 residues), 824.7 bits, see alignment E=1.4e-252

Best Hits

Swiss-Prot: 100% identical to KDPA_AGRFC: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to atu:Atu3790)

MetaCyc: 57% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U9D8 at UniProt or InterPro

Protein Sequence (567 amino acids)

>Atu3790 potassium-transporting ATPase subunit A (Agrobacterium fabrum C58)
MTLNGWFQVLLFCGIVFALVKPLGFYMARVFNGERTLLSPVLAPVERGLYALAGTSEREE
QHWTTYAFSMLLFNLFGFALLYALMRFQAVMPYNPQAMPAVGPELSFNTAVSFVTNTNWQ
NYGGESTLSYLTQMSGLTVQNFVSAATGMAIAIGLIRAFSRASGKAIGNFWVDMVRSTLY
VLLPLCIVLTLVYVWLGVPQTLGPYITAQTLEGAQQTIAVGPVASQLAIKMLGTNGGGFF
NANSAHPFENPDAISNMIQMVSIFAIGAAFTNVFGRMVGNQRQGWAILAAMGVLFIAGVA
VTYWAEAAGNPLMHGFGLAGGNMEGKEVRFGVALSSLFAVITTAASCGAVNAMHGSFTAL
GGLVPLINMQLGEVIVGGVGAGFYGILLFIVIAIFVAGLMVGRTPEYLGKKIEAKEMKMA
VLAILCLPLAMLAFTATATVLPSAVASIGTAGPHGFSEILYAYTSAAANNGSAFGGLTGN
TTWYNITLGFGMLMGRFLVIIPALAIAGSLVTKKTVPASAGTFPTDGPLFVGLLVGTILI
VGGLTFLPALALGPVAEHLVMAAGQLF