Protein Info for Atu3785 in Agrobacterium fabrum C58

Annotation: threonine aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF01212: Beta_elim_lyase" amino acids 3 to 291 (289 residues), 180.2 bits, see alignment E=2.9e-57

Best Hits

Swiss-Prot: 47% identical to LTAE_PSEAE: Low specificity L-threonine aldolase (ltaE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01620, threonine aldolase [EC: 4.1.2.5] (inferred from 100% identity to atu:Atu3785)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFN2 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Atu3785 threonine aldolase (Agrobacterium fabrum C58)
MFFASDNWAGAHPAVNERLSRESTRFAAAYGTSELDLSIEKRFNEIFEREVAVFFVATGT
AANSLSLASIARPGGLTFCHSEAHVIEDECGAPDFFSGMRMVAVEGPDGKMLPENLIERI
ARYPQDAVHHGRAAAITMTQATEAGTVYTLDEIDAISKIAKENGLPLHMDGARFANALAA
LGTTPAEMTWKRGVDVLSFGGTKNGCWCAEAIVFFDPSLARDFSFLRKRTAQLFSKSRFI
AAQFEAYLQDDLWLGLAGHANAMANRLRAGFGSLNSARLAWPTQANEVFAILPKAAAEAA
TQKGAKFYDWLEPRDMPENVGKDEVLIRMVTSFATTEADVDEFLSICAAV