Protein Info for Atu3755 in Agrobacterium fabrum C58

Annotation: phosphoribosylaminoimidazole carboxylase ATPase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 8 to 350 (343 residues), 387.3 bits, see alignment E=4e-120 PF02222: ATP-grasp" amino acids 115 to 282 (168 residues), 184.5 bits, see alignment E=1.3e-58 PF17769: PurK_C" amino acids 308 to 353 (46 residues), 56.9 bits, see alignment 1.4e-19

Best Hits

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 100% identity to atu:Atu3755)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CT83 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Atu3755 phosphoribosylaminoimidazole carboxylase ATPase subunit (Agrobacterium fabrum C58)
MAKTNNLTIGIIGGGQLGRMLAMAAARLNHRTIVLEPQADCPAAQVCNDQIVAEYDDEKA
LAELASRCDVVTYEFENVPVAAAEKLSASVPVYPPAQALSASQDRLTEKRFLNGCGIPTA
DFRAVDSQDELEAALTAFGGKGVLKTRRMGYDGKGQRLFRGGENLTGAFAALGGVPLILE
SFVAFEREISIIAARFQDGTVTCYDPAENVHLNGILHTSTVPAALSDAAKAVAVQSAEKL
LAALEYVGVIGIEFFVLPDGSLVANEMAPRVHNTGHWTEAACAISQFEQHIRAVSDLAPG
STDRHSDCVMTNLIGDDINDVPAWLSKKDCLVHLYGKTEARPGRKMGHVTELLHTGKA