Protein Info for Atu3744 in Agrobacterium fabrum C58

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 150 to 167 (18 residues), see Phobius details amino acids 173 to 191 (19 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 14 to 588 (575 residues), 869.3 bits, see alignment E=6.8e-266 PF00664: ABC_membrane" amino acids 33 to 297 (265 residues), 165.9 bits, see alignment E=2.4e-52 PF00005: ABC_tran" amino acids 369 to 517 (149 residues), 119.9 bits, see alignment E=2e-38

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to atu:Atu3744)

Predicted SEED Role

"ABC-type multidrug transport system, ATPase and permease components"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFL3 at UniProt or InterPro

Protein Sequence (599 amino acids)

>Atu3744 ABC transporter permease (Agrobacterium fabrum C58)
MADIDEQKAAKQRSLKPLLGLFPYLRRYRGLMAAALFALVLSSATTLALPLAVRRIIDHG
FQTPDGGMINSYFAMLLAIAVVLALASAMRYYYVMTIGERVVADLRRDVFAHLTTLSQQF
FDSNRSGELTSRLTADTVQIRSAFGSSASVALRNIIMCCGAVAMMIYTSPGLSGLALLAI
PFIVFPLIAFGRSVRARSRTTQDTLANSAAYASETIAASRTVQSFNAEVLANARYGASVE
AAYQGARAAIGARSVLTAVAIALVFGSVVGILWYGAQNVLAGSMTAGTLGQFVLYSVIAA
SGLGQLSEVWGELAQAGGAAERLSELLNERSPVAEPAAPVAMPQPPRGEAEFDNVDFVYP
LATGRPIVSGLSLKVAAGETVAIVGPSGAGKSTVFSLLMRFYDPQQGRITIDGVDIRNVS
LADLRARLSIVPQDVAIFASSIHDNIAFGRPEATREDVRAAAIAAQADGFIERLGDGYDT
QVGERGVTLSGGQRQRIAIARAILRDAPILLLDEATSALDAESETLVQKALDELMKTRTT
IVIAHRLATVLKADRILVMDEGRIIEEGTHQSLIRQNGLYARLARLQFQTGPDELRAQA