Protein Info for Atu3709 in Agrobacterium fabrum C58

Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 transmembrane" amino acids 24 to 36 (13 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details PF02878: PGM_PMM_I" amino acids 3 to 136 (134 residues), 154.2 bits, see alignment E=3.5e-49 TIGR01455: phosphoglucosamine mutase" amino acids 6 to 444 (439 residues), 646.9 bits, see alignment E=7.1e-199 PF02879: PGM_PMM_II" amino acids 159 to 256 (98 residues), 59 bits, see alignment E=1.2e-19 PF02880: PGM_PMM_III" amino acids 260 to 368 (109 residues), 124.1 bits, see alignment E=6.1e-40 PF00408: PGM_PMM_IV" amino acids 376 to 440 (65 residues), 65.3 bits, see alignment E=8.6e-22

Best Hits

Swiss-Prot: 100% identical to GLMM_AGRFC: Phosphoglucosamine mutase (glmM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to atu:Atu3709)

MetaCyc: 51% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8) / Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis or Alginate metabolism or Mannose Metabolism (EC 5.4.2.10, EC 5.4.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.10 or 5.4.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U9L9 at UniProt or InterPro

Protein Sequence (450 amino acids)

>Atu3709 phosphoglucosamine mutase (Agrobacterium fabrum C58)
MARRYFGTDGIRGQSNVFPMTPDLAMRVGIAVGTIFRRGHHRHRVVIGKDTRLSGYMLEN
ALVAGFTAAGLDVFLLGPIPTPAVAMLTRSLRADIGVMISASHNPFSDNGIKLFGPDGYK
LSDELELEIEDLLDKDIYAQLAKPAEIGRAKRVDGDIYRYIEFVKRTLPRDVTLSGLRIA
IDCANGAAYKVAPAALWELGAEVVTIGNEPNGININLECGSTHPEALQKKLHEVRADIGI
ALDGDADRVIIVDERGEIVDGDQLMAVIADSWAADNTLRGGGIVATVMSNLGLERFLGDK
GLTLARTKVGDRYVVEHMRNHNFNVGGEQSGHIVLSDYGTTGDGLVAALQVLAKVKRSGL
TVSEVCRKFEPVPQLLKNVRISGGKPLENPIVLQAIADAESALANNGRLVIRPSGTEPLI
RVMAEGDDSAKVEKIVNDLVGVISSARSAA