Protein Info for Atu3704 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 123 to 149 (27 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 334 to 351 (18 residues), see Phobius details amino acids 363 to 379 (17 residues), see Phobius details PF10129: OpgC_C" amino acids 7 to 384 (378 residues), 281.5 bits, see alignment E=4.5e-88

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3704)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CT44 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Atu3704 hypothetical protein (Agrobacterium fabrum C58)
MKRFDLIDGMRGYFLVFMLINHLVFAGGFWLVEINHRQFAFVEDAQGFVFLSGLLIGMVY
ARKMMKYGYDAGKQMIWNRAMELYRYAMGLVIAVLFFRMVIPHAPYIWYNWLGMTSFDDP
LRLAAIATFLFQPTFMDILPQYIVYMLFAPVLVKLCLDGKWAYVMAGSLLVWMAGQLGLQ
QIVTTPLNELVKGADEQGIRVSFNLLGWQLVFYSALVMGAMTAQNRIPWKKIFSPEHTWL
PKAALLICLFFMPLRIATAWGLMPEFMMGKFSTMEIRADFGPVYLINFLAVGVGLTWLVI
AGPQHHRPIVRSIAEGVIWVLSLKFLQLLGRHSLQVYVWHVAIVYAVYYLDGRTAELSQL
NKTLIAFTAIGLLALPALWRERDKWFGTSGQKTAGA