Protein Info for Atu3690 in Agrobacterium fabrum C58

Annotation: iron (III ABC transporter permease dicitrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 54 to 73 (20 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 191 to 203 (13 residues), see Phobius details amino acids 230 to 258 (29 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details PF01032: FecCD" amino acids 13 to 318 (306 residues), 310.4 bits, see alignment E=6e-97

Best Hits

Swiss-Prot: 40% identical to YFHA_BACSU: Probable siderophore transport system permease protein YfhA (yfhA) from Bacillus subtilis (strain 168)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to atu:Atu3690)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFJ5 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Atu3690 iron (III ABC transporter permease dicitrate ABC transporter permease (Agrobacterium fabrum C58)
MTRAITVLIILNLLAVIAAMIWGDQSIAWRDVANALVGSAPADLHMIVIEFRLSRAMLAL
LAGTGLAVAGTISQTVMRNPLAEPGVLGINAGAALVASVVIILFADVSPTILPWAGFAGA
VTMAATVYALAWKRGTSSLRIILVGIGLSAMAGAGTSFLTAFGNVMDVQRAMIWLSGSVY
GADWTKVKSLLLWLSVPLALTWFSCRQLDLIRFGDDVATGLGQKVNLVRAFLILLCTLIS
GATVAMVGLVGFVGLIAPHVARRIVGPAHRALIPVAALTGSLLLLVADIIGRTVIAPAQL
PAGIVTALLGAPFFAYLLKGRRHA