Protein Info for Atu3669 in Agrobacterium fabrum C58

Annotation: siderophore biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details amino acids 63 to 84 (22 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 246 to 271 (26 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 357 to 381 (25 residues), see Phobius details amino acids 394 to 421 (28 residues), see Phobius details amino acids 424 to 428 (5 residues), see Phobius details PF01554: MatE" amino acids 27 to 173 (147 residues), 51.8 bits, see alignment E=4e-18 amino acids 251 to 411 (161 residues), 71.1 bits, see alignment E=4.6e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3669)

Predicted SEED Role

"Na+ driven multidrug efflux pump"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CT14 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Atu3669 siderophore biosynthesis protein (Agrobacterium fabrum C58)
MEQGAATADKEDFNARGKPTLFQLSFPLLLHSLLSFFVNLADTAIISAYSAEAAAAVAVA
KQVMMIAFELSGLVGIGAVIVISRHLGRGEVEAARQVVAVALLTNTLVGLALGLSLMVAG
PLVLEQLAGSTSLNDEAGLYLNIVAVGMVFNGFIAAGLACLRAFGHSRLILAFGVGVSAF
YLLAEWVLILGVGPLPGMGVKGAALGTFSIRVMTTAILTPVLMWKLGLRFSFSDTVARFA
TARRMIAIALPSVTDYIAYSFYQIILLGLVARFGVEAVLGRTYTMLAMAFLIVVVMAISQ
SNEVLIGYRFGERRLEAATSQALRSASLAAAATTSIATLIWLASVPYIRLFTDNPAVIEL
CGSLLFLTIFIQPGFAFNTILFQSLRAVGDVRWPVFVSLTVTWGLGLSTAWFFCLFLNLG
VTGVWLSLIIEETVKGSLFLHRWLSRGVRHEAG