Protein Info for Atu3642 in Agrobacterium fabrum C58

Annotation: vgrG protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 754 TIGR03361: type VI secretion system Vgr family protein" amino acids 18 to 536 (519 residues), 564.4 bits, see alignment E=2.2e-173 TIGR01646: Rhs element Vgr protein" amino acids 30 to 519 (490 residues), 368.8 bits, see alignment E=5.1e-114 PF05954: Phage_GPD" amino acids 36 to 347 (312 residues), 260.8 bits, see alignment E=2.4e-81 PF04717: Phage_base_V" amino acids 400 to 467 (68 residues), 44.8 bits, see alignment E=2e-15 PF22178: Gp5_trimer_C" amino acids 487 to 567 (81 residues), 71.9 bits, see alignment E=7.2e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3642)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSZ6 at UniProt or InterPro

Protein Sequence (754 amino acids)

>Atu3642 vgrG protein (Agrobacterium fabrum C58)
MNDQPSSSDFIQASRVLKVSSPLGEDQLLPERLSVEEGVSQLFDIRLTVRAKKEAVKPEE
LIGRLVDVSIEISQGDGDGGGVRRPFNGLVTELHEGPPITRGMRSYALTIRPQMWLLSRR
SDCRIWMDKTAVEIVETLFSEHGIPAPDTSGIISPPPAQHYSVQFNETDLDYLTRRFEED
GLFYWFSHEDGSHKLHVADSASGWLGPSPAAQGEGTVRLAQGSSDRNHINDWARRFSYVS
GQRAGADWNFETPGMVPGTMTPSLVQMPDATKRELYEYPARIKTVEEAERAQKLRTQSIE
ADHDRVFGSSTTRILEAGRRFTPFEVAHPEHAYEEHVIVRASHSIVDLSYETNSNEPEYR
NHFEAIPARVPLTPHRSTKRPRIEGTQVAIVAGPEGEEIHPDQYGRIKLWFPWDRKAKKD
GTDTCWVRVSQAWGGGTWGAQVIPRIGMEVMVAFVDGDPDKPLVIGVVNNPANSVPYDLP
ANKTRMVLRSNSHKGDGFNEITFEDEAGKENQFFHAQKDQTTRVLNDRTKRIDRHEVASV
GGNRAVEVSGNQKHEIGGSVNTVVGGTGPMAMMAMAGVQALSGQTAGLLSQAAQIAGSGG
PGVAAFATTLASSALGFLGAGGLSSREGVVSGPSPRADAGTALAGSGSGVGSDASGLFPL
PGIMNTIVSTFKSDSVGVARAEQIGVSKVTNVGQTSLESVGKFKKIAVGEEFVIECGDSK
FIMKANGEVIILGKTFNFVATDHFQLRGKPIDLN