Protein Info for Atu3634 in Agrobacterium fabrum C58

Annotation: penicillin-binding protein dacf precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details PF00768: Peptidase_S11" amino acids 46 to 270 (225 residues), 196.7 bits, see alignment E=4.4e-62 PF13354: Beta-lactamase2" amino acids 56 to 197 (142 residues), 47.6 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: K01286, D-alanyl-D-alanine carboxypeptidase [EC: 3.4.16.4] (inferred from 100% identity to atu:Atu3634)

Predicted SEED Role

"D-alanyl-D-alanine carboxypeptidase (EC 3.4.16.4)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.16.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.16.4

Use Curated BLAST to search for 3.4.16.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSY9 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Atu3634 penicillin-binding protein dacf precursor (Agrobacterium fabrum C58)
MVNIAIPRLKTGIRGLALPNTVKSPNAARRLSAAIAIVTAGVVAVAPVANANPKMVVDVK
TGKVISHQEAFRKWYPASLTKLMTAYIAFSQMKAGKISPQTEVVMSKKAADQPASKMYFK
PGQKLTMDSALKLLLIKSANDIAVAIAETIGGTSDNFVAQMNAQAQRLGMSSTHYVNPNG
LPGKGQYTTARDLALLALIIKREFPEYAHYFSLEGVTTGKKNYANFNMLVGRFEGADGMK
TGFICASGFNQVASAVRNGRSVITVVLGADSLAGRTDQSADLLQMGLTAPSGQGVSLASL
APYGDTAEVNDISAEICNPKAAKVRSEGRDEAGRMVIHSPYVTEMTRPPEYSFAGLIPGS
ETVAVNAPKGAAGKGQLANVPIPIPRPTF