Protein Info for Atu3630 in Agrobacterium fabrum C58

Annotation: acetyl-CoA carboxylase carboxyltransferase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00513: acetyl-CoA carboxylase, carboxyl transferase, alpha subunit
  • amino acids 2 to 315 (314 residues), 416.1 bits, E=5.5e-129
• PF03255: ACCA
  • amino acids 4 to 314 (311 residues), 467.2 bits, E=2.5e-144
• PF01039: Carboxyl_trans
  • amino acids 100 to 246 (147 residues), 75.9 bits, E=2.7e-25

Best Hits

Swiss-Prot: 100% identical to ACCA_AGRFC: Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (accA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01962, acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC: 6.4.1.2] (inferred from 100% identity to atu:Atu3630)

MetaCyc: 50% identical to acetyl-CoA carboxyltransferase subunit alpha (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase alpha chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (15/16 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• propanoyl CoA degradation I (3/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• superpathway of fatty acid biosynthesis initiation (4/5 steps found)
• 2-oxobutanoate degradation I (3/4 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• methylaspartate cycle (12/19 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• candicidin biosynthesis (1/6 steps found)
• jadomycin biosynthesis (3/9 steps found)
• superpathway of L-methionine salvage and degradation (8/16 steps found)
• superpathway of candicidin biosynthesis (4/11 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

See Q8U9U5 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Atu3630 acetyl-CoA carboxylase carboxyltransferase subunit alpha (Agrobacterium fabrum C58)
MHNYLDFEKPISDLEGKIIELKKLADEDESIDTSEEINRLESRVNDAMQDIYSKLNAWQK
TQVARHPQRPHFVDYAKSLFTDFTPLAGDRKFSEDAAIQAGLARFNGQPVAIIGQEKGND
TKSRLKHNFGSARPEGYRKAIRVLELADRFSLPVVTLIDTAGAYPGVGAEERGQAEAIAR
STEMCLNVKVPIVSVVIGEGGSGGAIAIATGNRVYMLEHSVYSVISPEGAASILWRDSTR
AKEAATNMKITSEDLKSLGVIDGIIPEPIGGAHRAPETVISATGDVIAKALADLSQRSGT
QLRAERRQKFLDIGRNL