Protein Info for Atu3629 in Agrobacterium fabrum C58

Annotation: site-specific tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF13495: Phage_int_SAM_4" amino acids 14 to 91 (78 residues), 32.2 bits, see alignment E=1.7e-11 PF02899: Phage_int_SAM_1" amino acids 14 to 96 (83 residues), 75.6 bits, see alignment E=4.7e-25 PF00589: Phage_integrase" amino acids 125 to 311 (187 residues), 144.7 bits, see alignment E=3.8e-46

Best Hits

Swiss-Prot: 100% identical to XERD_AGRFC: Tyrosine recombinase XerD (xerD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 100% identity to atu:Atu3629)

Predicted SEED Role

"Tyrosine recombinase XerD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U9U6 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Atu3629 site-specific tyrosine recombinase XerD (Agrobacterium fabrum C58)
MSGQPMAGRDGARLESFLEMMSAERGAAANTLSSYEHDLADLREFLGRRGQSLTEAQTPD
LSAYLTHLAAQGFAATSQARRLSSMRQFYRFLYSEGLRGDDPTGIIDAPRKGLALPKTMS
VADVNRLLGLAAQEAATEGPGQLARIRMHLLLELLYATGMRVSELVSLPVKVLRQEGRFL
MIRGKGNKDRMVLLSRAAIEAMEKYEAGRKALSQEKSKAAASQKKTDTAESPWLFPSNSK
EGHLPRQVFARDLKDIAIRAGLTASAVSPHVLRHAFASHLLQNGADLRAVQELLGHSDIS
TTQIYTHVLEERLQELVQTHHPLAKQGKNLD