Protein Info for Atu3625 in Agrobacterium fabrum C58

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR01357: 3-dehydroquinate synthase" amino acids 22 to 369 (348 residues), 361.4 bits, see alignment E=2.6e-112 PF13685: Fe-ADH_2" amino acids 26 to 141 (116 residues), 40.2 bits, see alignment E=7.3e-14 PF01761: DHQ_synthase" amino acids 77 to 189 (113 residues), 157 bits, see alignment E=2.8e-50 PF24621: DHQS_C" amino acids 191 to 340 (150 residues), 156 bits, see alignment E=1.3e-49

Best Hits

Swiss-Prot: 100% identical to AROB_AGRFC: 3-dehydroquinate synthase (aroB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 100% identity to atu:Atu3625)

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U9V0 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Atu3625 3-dehydroquinate synthase (Agrobacterium fabrum C58)
MTPSEIHADERLVHVPLGERAYDILIGPGLIGRAGGEISARLKGRRAAIITDEHVAPLYL
EGLMDGLQTDGIEAVSLTLPAGEKTKSFEHLVTVCDAVLSARVERNDAVIALGGGVIGDL
AGFAAGIVRRGVRFVQIPTSLLSQVDSSVGGKTGINTRHGKNLVGVFHQPDLVLADTAVL
DTLSPREFRAGYAEVVKYGLIDKPDFFFWLEKNWDDIRTGGPARIEAIATSCQAKADVVV
ADEKENGVRALLNLGHTFGHALEAATNYDSKRLVHGEGVAIGMVLAHQFSARLNLASPDD
AARVEAHLKAVGLPTTMKDIPGELPPVETLMAAIAQDKKVKGGKLTFILTHGIGQSFVAD
DVASSEVQSFLSEKHPG