Protein Info for Atu3624 in Agrobacterium fabrum C58

Annotation: stress induced morphogen

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 93 PF01722: BolA" amino acids 11 to 89 (79 residues), 100.5 bits, see alignment E=2.6e-33

Best Hits

Swiss-Prot: 70% identical to YCB1_SINSX: Uncharacterized protein in cobS 5'region from Sinorhizobium sp.

KEGG orthology group: K05527, BolA protein (inferred from 100% identity to atu:Atu3624)

Predicted SEED Role

"Cell division protein BolA" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSY2 at UniProt or InterPro

Protein Sequence (93 amino acids)

>Atu3624 stress induced morphogen (Agrobacterium fabrum C58)
MSLRERIETKLRQSFSPERLRVVDESRMHAGHQPDMTGTGETHMRVQIVSESFSGKSRIE
RHRAINALLKPELDAGLHALAIEAAAPGEPTRF