Protein Info for Atu3623 in Agrobacterium fabrum C58

Annotation: DnaJ family molecular chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00226: DnaJ" amino acids 154 to 207 (54 residues), 56.8 bits, see alignment E=1e-19

Best Hits

Swiss-Prot: 74% identical to YCB2_SINSX: Uncharacterized 19.0 kDa protein in cobS 5'region from Sinorhizobium sp.

KEGG orthology group: None (inferred from 100% identity to atu:Atu3623)

Predicted SEED Role

"FIG003437: hypothetical with DnaJ-like domain" in subsystem Conenzyme B12 related Hypothetical: Clusters with cobST

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSY1 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Atu3623 DnaJ family molecular chaperone (Agrobacterium fabrum C58)
MKLDSKYFDRIRTRRKREREPEVQAPTCQWDGCDKPGIHRAPVGRNAEGQFFLFCFEHVK
EYNKGYNYFSGLSDSEIARYQKEAITGHRPTWTVGVNKTARDAPLHSTLRSGTASANARI
RDPFGFTGGFADGARAGGQRMQRDRKLKTLEAKAFDTLGLSSSAKQEEIKRRYKELVKKH
HPDANGGDRGSEERFRAVVQAYQLLKQSGFC