Protein Info for Atu3622 in Agrobacterium fabrum C58

Annotation: cobalamin biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR01650: cobaltochelatase, CobS subunit" amino acids 1 to 326 (326 residues), 652.3 bits, see alignment E=7.1e-201 PF12556: CobS_N" amino acids 7 to 40 (34 residues), 63.9 bits, see alignment 8.5e-22 PF07728: AAA_5" amino acids 67 to 191 (125 residues), 41 bits, see alignment E=1.9e-14

Best Hits

Swiss-Prot: 93% identical to COBS_SINSX: Aerobic cobaltochelatase subunit CobS (cobS) from Sinorhizobium sp.

KEGG orthology group: K09882, cobaltochelatase CobS [EC: 6.6.1.2] (inferred from 100% identity to atu:Atu3622)

MetaCyc: 93% identical to CobS (Pseudomonas denitrificans (nom. rej.))

Predicted SEED Role

"Aerobic cobaltochelatase CobS subunit (EC 6.6.1.2)" in subsystem Coenzyme B12 biosynthesis or Conenzyme B12 related Hypothetical: Clusters with cobST (EC 6.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.6.1.2

Use Curated BLAST to search for 6.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFG7 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Atu3622 cobalamin biosynthesis protein (Agrobacterium fabrum C58)
MSKIDLDISNLPDTTVSVREVFGIDTDLRVPAYSQGDAYVPDLDPDYLFDRDTTLAILAG
FAHNRRVMVSGFHGTGKSTHIEQVAARLNWPCVRVNLDSHVSRIDLVGKDAIVLKDGKQV
TEFKDGILPWAYQHNVALVFDEYDAGRPDVMFVIQRVLESSGRLTLLDQSRVIRPHPAFR
IFATANTVGLGDTTGLYHGTQQINQAQMDRWSIVTTLNYLPHEQEVNIIAAKVKSFDNPK
GRETVSKMVRVADLTRSAFINGDLSTVMSPRTVITWAENAEIFGDLAFAFRVTFLNKCDE
LERTLVAEQYQRAFGVELKESAANIVLSA