Protein Info for Atu3618 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 123 to 148 (26 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details PF02592: Vut_1" amino acids 43 to 85 (43 residues), 32.4 bits, see alignment 5.9e-12 amino acids 86 to 193 (108 residues), 61.4 bits, see alignment E=6.6e-21 TIGR00697: conserved hypothetical integral membrane protein" amino acids 87 to 195 (109 residues), 54.4 bits, see alignment E=7.3e-19

Best Hits

KEGG orthology group: K09125, hypothetical protein (inferred from 100% identity to atu:Atu3618)

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CSX6 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Atu3618 hypothetical protein (Agrobacterium fabrum C58)
MPYLRFTIIYVLLMTLVVVASNILVQYPLSGSLFGINLGDLLTWGAFTYPVAFLVTDLTN
RQFGPSVARRVVLAGFIVGVTLSFWTSIPRIAVASGTAYLIGQLLDISVFNRLRRQRWWH
APLAGSMLGSVLDTALFFSIAFAASFSFVGPNDAFAIESAPLLGVFALEAPRWISWALGD
LSVKVLVGLVMLLPYGALMNTLKPMPGTVKPS