Protein Info for Atu3613 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08241: Methyltransf_11
  • amino acids 87 to 130 (44 residues), 42.1 bits, 1.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu3613)

Predicted SEED Role

"SAM-dependent methyltransferase 2, in cluster with Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions (EC 3.1.2.6)

MetaCyc Pathways

• methylglyoxal degradation VIII (3/3 steps found)
• methylglyoxal degradation I (2/3 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

See Q7CSX1 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Atu3613 hypothetical protein (Agrobacterium fabrum C58)
MNTDIVDLREFYHSPLGRSAEQAITMALSTLWPPLPEERLVGLGYAVPFLERFRHDTERT
FAFMPAGQGAVNWPAGELSSTALVFDEELPLPDSSIDRVLMVHALEFAENPRESLKELWR
VLAPGGRLVIVVPNRRGVWARMEHTPFGSGRPYSRGQLTALLRETNFTPGASAEALFFPP
TTSRPVLKFRRYLERTGRRLWPLFSGVIVVEAQKRLYQGLPVTQRASRRVFVPVLAPQGV
PTTRTTARQGKPR