Protein Info for Atu3603 in Agrobacterium fabrum C58

Annotation: two component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 84.5 bits, see alignment E=3e-28

Best Hits

Swiss-Prot: 40% identical to CPDR_BRUA2: Response regulator receiver protein CpdR (cpdR) from Brucella abortus (strain 2308)

KEGG orthology group: None (inferred from 100% identity to atu:Atu3603)

Predicted SEED Role

"Two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFF6 at UniProt or InterPro

Protein Sequence (119 amino acids)

>Atu3603 two component response regulator (Agrobacterium fabrum C58)
MAKILITEDEDALRAFVARALRLDGHETHEAADGEQGLEKLQQTSFDLLLSDIRMPVMDG
IELAHRAAESFPAMRILLMTGYAEQRERADDLATKIVDVVSKPFALPDIRKAVARALAA