Protein Info for Atu3601 in Agrobacterium fabrum C58

Annotation: diaminopimelate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR01048: diaminopimelate decarboxylase" amino acids 8 to 415 (408 residues), 485 bits, see alignment E=7.3e-150 PF00278: Orn_DAP_Arg_deC" amino acids 29 to 373 (345 residues), 104.4 bits, see alignment E=4.7e-34 PF02784: Orn_Arg_deC_N" amino acids 35 to 281 (247 residues), 219.1 bits, see alignment E=9.7e-69 PF01168: Ala_racemase_N" amino acids 36 to 234 (199 residues), 26.1 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 52% identical to DCDA_PSEAE: Diaminopimelate decarboxylase (lysA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to atu:Atu3601)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CFF5 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Atu3601 diaminopimelate decarboxylase (Agrobacterium fabrum C58)
MNHFGYIDGVLHAENVPVPEIAKAVGTPFYVYSTATLERHYKVFSGAFADVDAMVCYAMK
ANSNQAVLKTLAKLGAGIDVVSGGELRRALAAGVPASRIMFSGVGKTVAEMDYALEAGIY
CFNIESEPELEVLNLRAVKAGKRAHVSFRINPDVDARTHAKISTGKKENKFGISYERARA
VYAHAATLPGIEVTGIDMHIGSQITELQPFEDAFRLLRELVEVLRTDGHAISHVDIGGGL
GIPYRDDNNPPPLPDAYAHIVKNELKSLNCKIVTEPGRLIVGNAGILVTEVIYVKDGGDK
TFVIVDGAMNDLIRPTLYEAYHGIRPVVQPSENAPRIKADIVGPVCETGDYLALDREMAA
PQPGDLIAVSSAGAYGAVQAGTYNSRLLVPEVLVKGDRFHVIRPRGTYEELIALDSVPAW
LD